PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009594219.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 343aa    MW: 38736.2 Da    PI: 7.6839
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009594219.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.64.3e-52141391128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrF Ptdeel+v+yL++kv+g++++l ++i+e+d+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++ 
  XP_009594219.1  14 LPPGFRFYPTDEELLVQYLCRKVAGHDFSL-QIIAEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITT- 106
                     79***************************9.89***************7777799***********************************9999. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  XP_009594219.1 107 EGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRL 139
                     999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.54E-678163IPR003441NAC domain
PROSITE profilePS5100560.25114162IPR003441NAC domain
PfamPF023653.3E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MGVQEMDPLS QLSLPPGFRF YPTDEELLVQ YLCRKVAGHD FSLQIIAEID LYKFDPWVLP  60
SKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIITTEGRK VGIKKALVFY  120
VGKAPKGTKT NWIMHEYRLG ESPRKNGSSR LDEWVLCRIY KKNSGGQKPN ISGLSSKEIS  180
HGSSSSSSSQ FDDMLESLPE IEDRYFSLPR MNSLRNLQQD DKLNLQHLGS GNFDWATLAG  240
FNSFPELGTG NQSQVHLNNQ NSNNNLNNLN EFFAHPTQLN FHGDVKFEGG VDDEVESGIR  300
AQRVNNSGFY QENSTGLQAY TNSVPDPFGI RYPTQTVNMG FSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-11011684171NO APICAL MERISTEM PROTEIN
1ut4_B1e-11011684171NO APICAL MERISTEM PROTEIN
1ut7_A1e-11011684171NO APICAL MERISTEM PROTEIN
1ut7_B1e-11011684171NO APICAL MERISTEM PROTEIN
3swm_A1e-11011687174NAC domain-containing protein 19
3swm_B1e-11011687174NAC domain-containing protein 19
3swm_C1e-11011687174NAC domain-containing protein 19
3swm_D1e-11011687174NAC domain-containing protein 19
3swp_A1e-11011687174NAC domain-containing protein 19
3swp_B1e-11011687174NAC domain-containing protein 19
3swp_C1e-11011687174NAC domain-containing protein 19
3swp_D1e-11011687174NAC domain-containing protein 19
4dul_A1e-11011684171NAC domain-containing protein 19
4dul_B1e-11011684171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009594219.10.0PREDICTED: NAC domain-containing protein 72
RefseqXP_016484889.10.0PREDICTED: NAC domain-containing protein 72-like
SwissprotQ93VY31e-129NAC72_ARATH; NAC domain-containing protein 72
TrEMBLK4CH240.0K4CH24_SOLLC; Uncharacterized protein
STRINGSolyc07g063410.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31222452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-126NAC family protein